AN-HPA041740-100ul
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.
Size | 100ul |
Gene Name | RERGL |
Gene Description | RERG/RAS-like |
Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Shipping Conditions | Normally shipped at ambient temperature |
Species Reactivity Cross | Human, Mouse, Rat |
Applications | IHC, WB |
Sequence | CKRAVESAVFLVGNKRDLCHVREVGWEEGQKLALENRCQFCELSAAEQSLEVEMMFIRIIKDILINFKLKEKRRPSGSKSMA |
Immunogen | CKRAVESAVFLVGNKRDLCHVREVGWEEGQKLALENRCQFCELSAAEQSLEVEMMFIRIIKDILINFKLKEKRRPSGSKSMA |
Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Product Group | Polyclonal Antibodies |
Alternative Names | FLJ22655 |
Category | Polyclonal |
Isoelectric Point | IgG |
Host | RABBIT |
UniProt ID | Q9H628 |
HTS Code | 3002150000 |
Gene ID | 79785 |
Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Purification | Affinity purified using the PrEST antigen as affinity ligand |
Iso type | IgG |
Aplicativo | WB, IHC |
Conjugation | Unconjugated |