CORO1C,coronin-3
  • CORO1C,coronin-3

Anti-CORO1C Antibody 100ul

Ref: AN-HPA041737-100ul
Anti-CORO1C

Información del producto

Polyclonal Antibody against Human CORO1C, Gene description: coronin, actin binding protein, 1C, Alternative Gene Names: coronin-3, HCRNN4, Validated applications: IHC, Uniprot ID: Q9ULV4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CORO1C
Gene Description coronin, actin binding protein, 1C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKI
Immunogen ILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names coronin-3, HCRNN4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9ULV4
HTS Code 3002150000
Gene ID 23603
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CORO1C Antibody 100ul

Anti-CORO1C Antibody 100ul