CHST12,C4S-2,C4ST2
  • CHST12,C4S-2,C4ST2

Anti-CHST12 Antibody 25ul

Ref: AN-HPA041680-25ul
Anti-CHST12

Información del producto

Polyclonal Antibody against Human CHST12, Gene description: carbohydrate (chondroitin 4) sulfotransferase 12, Alternative Gene Names: C4S-2, C4ST2, Validated applications: IHC, WB, Uniprot ID: Q9NRB3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CHST12
Gene Description carbohydrate (chondroitin 4) sulfotransferase 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence VGKLETLDEDAAQLLQLLQVDRQLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLRD
Immunogen VGKLETLDEDAAQLLQLLQVDRQLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLRD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C4S-2, C4ST2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NRB3
HTS Code 3002150000
Gene ID 55501
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CHST12 Antibody 25ul

Anti-CHST12 Antibody 25ul