ANO3,C11orf25,DYT23
  • ANO3,C11orf25,DYT23

Anti-ANO3 Antibody 25ul

Ref: AN-HPA041629-25ul
Anti-ANO3

Información del producto

Polyclonal Antibody against Human ANO3, Gene description: anoctamin 3, Alternative Gene Names: C11orf25, DYT23, GENX-3947, TMEM16C, Validated applications: IHC, Uniprot ID: Q9BYT9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ANO3
Gene Description anoctamin 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DKRNTFEKNLRAEGLMLEKEPAIASPDIMFIKIHIPWDTLCKYAERLNIRMPFRKKCYYTDGRSKSMGRMQTYFRRIKNWMAQNPM
Immunogen DKRNTFEKNLRAEGLMLEKEPAIASPDIMFIKIHIPWDTLCKYAERLNIRMPFRKKCYYTDGRSKSMGRMQTYFRRIKNWMAQNPM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C11orf25, DYT23, GENX-3947, TMEM16C
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BYT9
HTS Code 3002150000
Gene ID 63982
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ANO3 Antibody 25ul

Anti-ANO3 Antibody 25ul