RNF165,ARKL2
  • RNF165,ARKL2

Anti-RNF165 Antibody 25ul

Ref: AN-HPA041615-25ul
Anti-RNF165

Información del producto

Polyclonal Antibody against Human RNF165, Gene description: ring finger protein 165, Alternative Gene Names: ARKL2, RNF111L2, Validated applications: ICC, IHC, Uniprot ID: Q6ZSG1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RNF165
Gene Description ring finger protein 165
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ALHQQYLLQQQLLEAQHRRLVSHPRRSQERVSVHPHRLHPSFDFGQLQTPQPRYLAEGTDWDLSVDAGLSPAQFQVRPIPQHYQHYLATPRMHHFPRNSSSTQ
Immunogen ALHQQYLLQQQLLEAQHRRLVSHPRRSQERVSVHPHRLHPSFDFGQLQTPQPRYLAEGTDWDLSVDAGLSPAQFQVRPIPQHYQHYLATPRMHHFPRNSSSTQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARKL2, RNF111L2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZSG1
HTS Code 3002150000
Gene ID 494470
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RNF165 Antibody 25ul

Anti-RNF165 Antibody 25ul