TSPAN16,TM-8,TM4-B
  • TSPAN16,TM-8,TM4-B

Anti-TSPAN16 Antibody 25ul

Ref: AN-HPA041579-25ul
Anti-TSPAN16

Información del producto

Polyclonal Antibody against Human TSPAN16, Gene description: tetraspanin 16, Alternative Gene Names: TM-8, TM4-B, TM4SF16, Validated applications: IHC, Uniprot ID: Q9UKR8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TSPAN16
Gene Description tetraspanin 16
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence IVGDVALEHTFVTLRKNYRGYNEPDDYSTQWNLVMEKLKCCGVNNYTDFSGSSFEMTTGH
Immunogen IVGDVALEHTFVTLRKNYRGYNEPDDYSTQWNLVMEKLKCCGVNNYTDFSGSSFEMTTGH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TM-8, TM4-B, TM4SF16
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UKR8
HTS Code 3002150000
Gene ID 26526
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TSPAN16 Antibody 25ul

Anti-TSPAN16 Antibody 25ul