SLC7A6OS,FLJ13291
  • SLC7A6OS,FLJ13291

Anti-SLC7A6OS Antibody 100ul

Ref: AN-HPA041533-100ul
Anti-SLC7A6OS

Información del producto

Polyclonal Antibody against Human SLC7A6OS, Gene description: solute carrier family 7, member 6 opposite strand, Alternative Gene Names: FLJ13291, Validated applications: ICC, IHC, WB, Uniprot ID: Q96CW6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC7A6OS
Gene Description solute carrier family 7, member 6 opposite strand
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB, IHC
Sequence AEALVLACKRLRSDAVESAAQKTSEGLERAAENNVFHLVATVCSQEEPVQPLLREVLRPSRDSQQRVRRNLRASAREVRQEGRYRVLS
Immunogen AEALVLACKRLRSDAVESAAQKTSEGLERAAENNVFHLVATVCSQEEPVQPLLREVLRPSRDSQQRVRRNLRASAREVRQEGRYRVLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ13291
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96CW6
HTS Code 3002150000
Gene ID 84138
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SLC7A6OS Antibody 100ul

Anti-SLC7A6OS Antibody 100ul