FAM96B,CGI-128
  • FAM96B,CGI-128

Anti-FAM96B Antibody 25ul

Ref: AN-HPA041501-25ul
Anti-FAM96B

Información del producto

Polyclonal Antibody against Human FAM96B, Gene description: family with sequence similarity 96, member B, Alternative Gene Names: CGI-128, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y3D0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAM96B
Gene Description family with sequence similarity 96, member B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence LIYQRSGERPVTAGEEDEQVPDSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQVSDPESTVAVAFTPTIP
Immunogen LIYQRSGERPVTAGEEDEQVPDSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQVSDPESTVAVAFTPTIP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-128
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3D0
HTS Code 3002150000
Gene ID 51647
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FAM96B Antibody 25ul

Anti-FAM96B Antibody 25ul