CNOT10,FLJ12890
  • CNOT10,FLJ12890

Anti-CNOT10 Antibody 25ul

Ref: AN-HPA041450-25ul
Anti-CNOT10

Información del producto

Polyclonal Antibody against Human CNOT10, Gene description: CCR4-NOT transcription complex, subunit 10, Alternative Gene Names: FLJ12890, FLJ13165, Validated applications: ICC, WB, Uniprot ID: Q9H9A5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CNOT10
Gene Description CCR4-NOT transcription complex, subunit 10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence PLAAFECLIEAVQVYHANPRLWLRLAECCIAANKGTSEQETKGLPSKKGIVQSIVGQGYHRKIVLASQSIQNTVYNDGQSSAIPV
Immunogen PLAAFECLIEAVQVYHANPRLWLRLAECCIAANKGTSEQETKGLPSKKGIVQSIVGQGYHRKIVLASQSIQNTVYNDGQSSAIPV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ12890, FLJ13165
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H9A5
HTS Code 3002150000
Gene ID 25904
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CNOT10 Antibody 25ul

Anti-CNOT10 Antibody 25ul