UBA2,ARX,FLJ13058
  • UBA2,ARX,FLJ13058

Anti-UBA2 Antibody 25ul

Ref: AN-HPA041436-25ul
Anti-UBA2

Información del producto

Polyclonal Antibody against Human UBA2, Gene description: ubiquitin-like modifier activating enzyme 2, Alternative Gene Names: ARX, FLJ13058, HRIHFB2115, SAE2, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UBT2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name UBA2
Gene Description ubiquitin-like modifier activating enzyme 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence DFLQDYTLLINILHSEDLGKDVEFEVVGDAPEKVGPKQAEDAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEDSSNNAD
Immunogen DFLQDYTLLINILHSEDLGKDVEFEVVGDAPEKVGPKQAEDAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEDSSNNAD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARX, FLJ13058, HRIHFB2115, SAE2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UBT2
HTS Code 3002150000
Gene ID 10054
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-UBA2 Antibody 25ul

Anti-UBA2 Antibody 25ul