CHMP4B,C20orf178
  • CHMP4B,C20orf178

Anti-CHMP4B Antibody 25ul

Ref: AN-HPA041401-25ul
Anti-CHMP4B

Información del producto

Polyclonal Antibody against Human CHMP4B, Gene description: charged multivesicular body protein 4B, Alternative Gene Names: C20orf178, dJ553F4.4, Shax1, SNF7-2, VPS32B, Validated applications: IHC, WB, Uniprot ID: Q9H444, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CHMP4B
Gene Description charged multivesicular body protein 4B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKK
Immunogen SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf178, dJ553F4.4, Shax1, SNF7-2, VPS32B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H444
HTS Code 3002150000
Gene ID 128866
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CHMP4B Antibody 25ul

Anti-CHMP4B Antibody 25ul