C10orf107,bA63A2.1
  • C10orf107,bA63A2.1

Anti-C10orf107 Antibody 25ul

Ref: AN-HPA041398-25ul
Anti-C10orf107

Información del producto

Polyclonal Antibody against Human C10orf107, Gene description: chromosome 10 open reading frame 107, Alternative Gene Names: bA63A2.1, Em:AC022398.2, MGC44593, Validated applications: IHC, Uniprot ID: Q8IVU9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C10orf107
Gene Description chromosome 10 open reading frame 107
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EMKRLDQEQGPEESQPETDTSDMDPLVGFTIEDVKSVLDQVTDDILIGIQTEINEKLQIQEEAFNARIE
Immunogen EMKRLDQEQGPEESQPETDTSDMDPLVGFTIEDVKSVLDQVTDDILIGIQTEINEKLQIQEEAFNARIE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA63A2.1, Em:AC022398.2, MGC44593
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IVU9
HTS Code 3002150000
Gene ID 219621
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C10orf107 Antibody 25ul

Anti-C10orf107 Antibody 25ul