GAS8,GAS11
  • GAS8,GAS11

Anti-GAS8 Antibody 25ul

Ref: AN-HPA041311-25ul
Anti-GAS8

Información del producto

Polyclonal Antibody against Human GAS8, Gene description: growth arrest-specific 8, Alternative Gene Names: GAS11, Validated applications: IHC, WB, Uniprot ID: O95995, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GAS8
Gene Description growth arrest-specific 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence VEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDLQYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQG
Immunogen VEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDLQYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GAS11
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95995
HTS Code 3002150000
Gene ID 2622
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GAS8 Antibody 25ul

Anti-GAS8 Antibody 25ul