CENPT,C16orf56
  • CENPT,C16orf56

Anti-CENPT Antibody 100ul

Ref: AN-HPA041220-100ul
Anti-CENPT

Información del producto

Polyclonal Antibody against Human CENPT, Gene description: centromere protein T, Alternative Gene Names: C16orf56, CENP-T, FLJ13111, Validated applications: ICC, Uniprot ID: Q96BT3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CENPT
Gene Description centromere protein T
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence RGRSHGARSVGRSAHIQASGHLEEQTPRTLLKNILLTAPESSILMPESVVKPVPAPQAVQPSRQESSCGSLELQLPELEPPTTLAPGLLAPGRRKQRLRLSVFQQGV
Immunogen RGRSHGARSVGRSAHIQASGHLEEQTPRTLLKNILLTAPESSILMPESVVKPVPAPQAVQPSRQESSCGSLELQLPELEPPTTLAPGLLAPGRRKQRLRLSVFQQGV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C16orf56, CENP-T, FLJ13111
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96BT3
HTS Code 3002150000
Gene ID 80152
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CENPT Antibody 100ul

Anti-CENPT Antibody 100ul