NDUFA13,B16.6
  • NDUFA13,B16.6

Anti-NDUFA13 Antibody 100ul

Ref: AN-HPA041213-100ul
Anti-NDUFA13

Información del producto

Polyclonal Antibody against Human NDUFA13, Gene description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13, Alternative Gene Names: B16.6, CDA016, CGI-39, GRIM-19, GRIM19, Validated applications: ICC, IHC, WB, Uniprot ID: Q9P0J0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NDUFA13
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, WB, IHC
Sequence IMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
Immunogen IMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B16.6, CDA016, CGI-39, GRIM-19, GRIM19
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P0J0
HTS Code 3002150000
Gene ID 51079
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NDUFA13 Antibody 100ul

Anti-NDUFA13 Antibody 100ul