WIPF3,CR16,FLJ36931
  • WIPF3,CR16,FLJ36931

Anti-WIPF3 Antibody 25ul

Ref: AN-HPA041145-25ul
Anti-WIPF3

Información del producto

Polyclonal Antibody against Human WIPF3, Gene description: WAS/WASL interacting protein family, member 3, Alternative Gene Names: CR16, FLJ36931, Validated applications: IHC, Uniprot ID: A6NGB9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WIPF3
Gene Description WAS/WASL interacting protein family, member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QIESSKGTNKEGGGSANTRGASTPPTLGDLFAGGFPVLRPAGQRDVAGGKTGQGPGSRAPSPRLPNKTISGPLIPPASPRLGNTS
Immunogen QIESSKGTNKEGGGSANTRGASTPPTLGDLFAGGFPVLRPAGQRDVAGGKTGQGPGSRAPSPRLPNKTISGPLIPPASPRLGNTS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CR16, FLJ36931
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A6NGB9
HTS Code 3002150000
Gene ID 644150
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-WIPF3 Antibody 25ul

Anti-WIPF3 Antibody 25ul