C10orf88
  • C10orf88

Anti-C10orf88 Antibody 25ul

Ref: AN-HPA040991-25ul
Anti-C10orf88

Información del producto

Polyclonal Antibody against Human C10orf88, Gene description: chromosome 10 open reading frame 88, Alternative Gene Names: Em:AC073585.5, FLJ13490, Validated applications: IHC, WB, Uniprot ID: Q9H8K7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C10orf88
Gene Description chromosome 10 open reading frame 88
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence PPAPGQDLVILKRNHNNKDENPCFLYLRCGPDGGEEIASIGILSSARNMEVYLGEEYCGTSRGKNVCTVLD
Immunogen PPAPGQDLVILKRNHNNKDENPCFLYLRCGPDGGEEIASIGILSSARNMEVYLGEEYCGTSRGKNVCTVLD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Em:AC073585.5, FLJ13490
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H8K7
HTS Code 3002150000
Gene ID 80007
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C10orf88 Antibody 25ul

Anti-C10orf88 Antibody 25ul