DTD1,bA379J5.3
  • DTD1,bA379J5.3

Anti-DTD1 Antibody 100ul

Ref: AN-HPA040981-100ul
Anti-DTD1

Información del producto

Polyclonal Antibody against Human DTD1, Gene description: D-tyrosyl-tRNA deacylase 1, Alternative Gene Names: bA379J5.3, bA555E18.1, C20orf88, DUEB, HARS2, MGC119131, MGC41905, pqn-68, Validated applications: IHC, WB, Uniprot ID: Q8TEA8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DTD1
Gene Description D-tyrosyl-tRNA deacylase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence SVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDKQYEILCVSQFT
Immunogen SVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDKQYEILCVSQFT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA379J5.3, bA555E18.1, C20orf88, DUEB, HARS2, MGC119131, MGC41905, pqn-68
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TEA8
HTS Code 3002150000
Gene ID 92675
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DTD1 Antibody 100ul

Anti-DTD1 Antibody 100ul