OSBPL1A,ORP-1,ORP1
  • OSBPL1A,ORP-1,ORP1

Anti-OSBPL1A Antibody 100ul

Ref: AN-HPA040959-100ul
Anti-OSBPL1A

Información del producto

Polyclonal Antibody against Human OSBPL1A, Gene description: oxysterol binding protein-like 1A, Alternative Gene Names: ORP-1, ORP1, OSBPL1B, Validated applications: IHC, Uniprot ID: Q9BXW6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name OSBPL1A
Gene Description oxysterol binding protein-like 1A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VPKNSLQQSREDWLEAIEEHSAYSTHYCSQDQLTDEEEEDTVSAADLKKSLEKAQSCQQRLDREISNFLKMIKECDMAKEMLPSFLQKVEVVSEA
Immunogen VPKNSLQQSREDWLEAIEEHSAYSTHYCSQDQLTDEEEEDTVSAADLKKSLEKAQSCQQRLDREISNFLKMIKECDMAKEMLPSFLQKVEVVSEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ORP-1, ORP1, OSBPL1B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BXW6
HTS Code 3002150000
Gene ID 114876
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-OSBPL1A Antibody 100ul

Anti-OSBPL1A Antibody 100ul