NAA60,FLJ14154,NAT15
  • NAA60,FLJ14154,NAT15

Anti-NAA60 Antibody 100ul

Ref: AN-HPA040916-100ul
Anti-NAA60

Información del producto

Polyclonal Antibody against Human NAA60, Gene description: N(alpha)-acetyltransferase 60, NatF catalytic subunit, Alternative Gene Names: FLJ14154, NAT15, Validated applications: IHC, WB, Uniprot ID: Q9H7X0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NAA60
Gene Description N(alpha)-acetyltransferase 60, NatF catalytic subunit
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence EVVPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAEIKNRTKI
Immunogen EVVPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAEIKNRTKI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ14154, NAT15
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H7X0
HTS Code 3002150000
Gene ID 79903
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NAA60 Antibody 100ul

Anti-NAA60 Antibody 100ul