PGBD4,FLJ32638
  • PGBD4,FLJ32638

Anti-PGBD4 Antibody 25ul

Ref: AN-HPA040896-25ul
Anti-PGBD4

Información del producto

Polyclonal Antibody against Human PGBD4, Gene description: piggyBac transposable element derived 4, Alternative Gene Names: FLJ32638, FLJ37497, Validated applications: IHC, WB, Uniprot ID: Q96DM1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PGBD4
Gene Description piggyBac transposable element derived 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence VLTLVNDLLGQGYCVFLDNFNISPMLFRELHQNRTDAVGTARLNRKQIPNDLKKRIAKGTTVARFCGELMALKWCDGKEVTMLSTFHNDTVIEVNNRNGKKTKR
Immunogen VLTLVNDLLGQGYCVFLDNFNISPMLFRELHQNRTDAVGTARLNRKQIPNDLKKRIAKGTTVARFCGELMALKWCDGKEVTMLSTFHNDTVIEVNNRNGKKTKR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ32638, FLJ37497
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96DM1
HTS Code 3002150000
Gene ID 161779
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PGBD4 Antibody 25ul

Anti-PGBD4 Antibody 25ul