FUT8
  • FUT8

Anti-FUT8 Antibody 100ul

Ref: AN-HPA040863-100ul
Anti-FUT8

Información del producto

Polyclonal Antibody against Human FUT8, Gene description: fucosyltransferase 8 (alpha (1,6) fucosyltransferase), Validated applications: ICC, Uniprot ID: Q9BYC5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FUT8
Gene Description fucosyltransferase 8 (alpha (1,6) fucosyltransferase)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRP
Immunogen MTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BYC5
HTS Code 3002150000
Gene ID 2530
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FUT8 Antibody 100ul

Anti-FUT8 Antibody 100ul