PPP2R3C,C14orf10
  • PPP2R3C,C14orf10

Anti-PPP2R3C Antibody 25ul

Ref: AN-HPA040835-25ul
Anti-PPP2R3C

Información del producto

Polyclonal Antibody against Human PPP2R3C, Gene description: protein phosphatase 2, regulatory subunit B'', gamma, Alternative Gene Names: C14orf10, FLJ20644, G4-1, G5PR, Validated applications: IHC, WB, Uniprot ID: Q969Q6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PPP2R3C
Gene Description protein phosphatase 2, regulatory subunit B'', gamma
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence LLDIENKGYLNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTVTTILIDLNGFWT
Immunogen LLDIENKGYLNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTVTTILIDLNGFWT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C14orf10, FLJ20644, G4-1, G5PR
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q969Q6
HTS Code 3002150000
Gene ID 55012
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PPP2R3C Antibody 25ul

Anti-PPP2R3C Antibody 25ul