SAXO2,DKFZp666G057
  • SAXO2,DKFZp666G057

Anti-SAXO2 Antibody 25ul

Ref: AN-HPA040833-25ul
Anti-SAXO2

Información del producto

Polyclonal Antibody against Human SAXO2, Gene description: stabilizer of axonemal microtubules 2, Alternative Gene Names: DKFZp666G057, FAM154B, Validated applications: IHC, Uniprot ID: Q658L1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SAXO2
Gene Description stabilizer of axonemal microtubules 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AWDLHKSELYKPEQTYHPPTVKFGNSTTFQDDFVPQEIKPRQSFKPSSVVKRSTAPFNGITSHRLDYIPHQLELKFERPKEVYKPTDQRFE
Immunogen AWDLHKSELYKPEQTYHPPTVKFGNSTTFQDDFVPQEIKPRQSFKPSSVVKRSTAPFNGITSHRLDYIPHQLELKFERPKEVYKPTDQRFE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp666G057, FAM154B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q658L1
HTS Code 3002150000
Gene ID 283726
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SAXO2 Antibody 25ul

Anti-SAXO2 Antibody 25ul