ZC3H7A,FLJ20318
  • ZC3H7A,FLJ20318

Anti-ZC3H7A Antibody 25ul

Ref: AN-HPA040808-25ul
Anti-ZC3H7A

Información del producto

Polyclonal Antibody against Human ZC3H7A, Gene description: zinc finger CCCH-type containing 7A, Alternative Gene Names: FLJ20318, HSPC055, ZC3H7, ZC3HDC7, Validated applications: ICC, IHC, WB, Uniprot ID: Q8IWR0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZC3H7A
Gene Description zinc finger CCCH-type containing 7A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB, IHC
Sequence SSLLLMNGPGSLFASENFLGISSQPRNDFGNFFGSAVTKPSSSVTPRHPLEGTHELRQACQICFVKSGPKLMDFTYHANIDHKCKKDILIGRIKNVEDK
Immunogen SSLLLMNGPGSLFASENFLGISSQPRNDFGNFFGSAVTKPSSSVTPRHPLEGTHELRQACQICFVKSGPKLMDFTYHANIDHKCKKDILIGRIKNVEDK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20318, HSPC055, ZC3H7, ZC3HDC7
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IWR0
HTS Code 3002150000
Gene ID 29066
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZC3H7A Antibody 25ul

Anti-ZC3H7A Antibody 25ul