NUDT13,DKFZp586P2219
  • NUDT13,DKFZp586P2219

Anti-NUDT13 Antibody 25ul

Ref: AN-HPA040636-25ul
Anti-NUDT13

Información del producto

Polyclonal Antibody against Human NUDT13, Gene description: nudix (nucleoside diphosphate linked moiety X)-type motif 13, Alternative Gene Names: DKFZp586P2219, Validated applications: ICC, IHC, Uniprot ID: Q86X67, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NUDT13
Gene Description nudix (nucleoside diphosphate linked moiety X)-type motif 13
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence QDAQRIEDSVLIGCSEQQEAWFALDLGLDSSFSISASLHKPEMETELKGSFIELRKALFQLNARDASLLSTAQALLRWH
Immunogen QDAQRIEDSVLIGCSEQQEAWFALDLGLDSSFSISASLHKPEMETELKGSFIELRKALFQLNARDASLLSTAQALLRWH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp586P2219
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86X67
HTS Code 3002150000
Gene ID 25961
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NUDT13 Antibody 25ul

Anti-NUDT13 Antibody 25ul