HMOX2,HO-2
  • HMOX2,HO-2

Anti-HMOX2 Antibody 25ul

Ref: AN-HPA040611-25ul
Anti-HMOX2

Información del producto

Polyclonal Antibody against Human HMOX2, Gene description: heme oxygenase (decycling) 2, Alternative Gene Names: HO-2, Validated applications: IHC, WB, Uniprot ID: P30519, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HMOX2
Gene Description heme oxygenase (decycling) 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence MERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPEL
Immunogen MERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPEL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HO-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P30519
HTS Code 3002150000
Gene ID 3163
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HMOX2 Antibody 25ul

Anti-HMOX2 Antibody 25ul