EEF2,EEF-2,EF2
  • EEF2,EEF-2,EF2

Anti-EEF2 Antibody 25ul

Ref: AN-HPA040534-25ul
Anti-EEF2

Información del producto

Polyclonal Antibody against Human EEF2, Gene description: eukaryotic translation elongation factor 2, Alternative Gene Names: EEF-2, EF2, Validated applications: ICC, IHC, WB, Uniprot ID: P13639, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EEF2
Gene Description eukaryotic translation elongation factor 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence CIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFG
Immunogen CIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EEF-2, EF2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P13639
HTS Code 3002150000
Gene ID 1938
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EEF2 Antibody 25ul

Anti-EEF2 Antibody 25ul