BTBD16,C10orf87
  • BTBD16,C10orf87

Anti-BTBD16 Antibody 100ul

Ref: AN-HPA040529-100ul
Anti-BTBD16

Información del producto

Polyclonal Antibody against Human BTBD16, Gene description: BTB (POZ) domain containing 16, Alternative Gene Names: C10orf87, Em:AC061711.1, FLJ25359, Validated applications: IHC, Uniprot ID: Q32M84, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BTBD16
Gene Description BTB (POZ) domain containing 16
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence FLDRDIGRSLRPLFLCLRLHGITKGKDLEVLRHLNFFPESWLDQVTVNHYHALENGGDMVHLKDLNTQAVRFGLLFNQENTTYSKTIALYGFFFK
Immunogen FLDRDIGRSLRPLFLCLRLHGITKGKDLEVLRHLNFFPESWLDQVTVNHYHALENGGDMVHLKDLNTQAVRFGLLFNQENTTYSKTIALYGFFFK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C10orf87, Em:AC061711.1, FLJ25359
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q32M84
HTS Code 3002150000
Gene ID 118663
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BTBD16 Antibody 100ul

Anti-BTBD16 Antibody 100ul