ULK3,DKFZP434C131
  • ULK3,DKFZP434C131

Anti-ULK3 Antibody 100ul

Ref: AN-HPA040474-100ul
Anti-ULK3

Información del producto

Polyclonal Antibody against Human ULK3, Gene description: unc-51 like kinase 3, Alternative Gene Names: DKFZP434C131, FLJ90566, Validated applications: IHC, WB, Uniprot ID: Q6PHR2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ULK3
Gene Description unc-51 like kinase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence ILKGIRHPHIVQLKDFQWDSDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQLASALQFLHERNISHLDLKPQNILLSSLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYMAPEMVCQRQYDARVDLWSMGVILYGETSFPC
Immunogen ILKGIRHPHIVQLKDFQWDSDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQLASALQFLHERNISHLDLKPQNILLSSLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYMAPEMVCQRQYDARVDLWSMGVILYGETSFPC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434C131, FLJ90566
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6PHR2
HTS Code 3002150000
Gene ID 25989
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ULK3 Antibody 100ul

Anti-ULK3 Antibody 100ul