SARAF,MGC8721,TMEM66
  • SARAF,MGC8721,TMEM66

Anti-SARAF Antibody 100ul

Ref: AN-HPA040400-100ul
Anti-SARAF

Información del producto

Polyclonal Antibody against Human SARAF, Gene description: store-operated calcium entry-associated regulatory factor, Alternative Gene Names: MGC8721, TMEM66, Validated applications: ICC, Uniprot ID: Q96BY9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SARAF
Gene Description store-operated calcium entry-associated regulatory factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence YSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFT
Immunogen YSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC8721, TMEM66
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96BY9
HTS Code 3002150000
Gene ID 51669
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SARAF Antibody 100ul

Anti-SARAF Antibody 100ul