SP4,HF1B,MGC130008
  • SP4,HF1B,MGC130008

Anti-SP4 Antibody 100ul

Ref: AN-HPA040395-100ul
Anti-SP4

Información del producto

Polyclonal Antibody against Human SP4, Gene description: Sp4 transcription factor, Alternative Gene Names: HF1B, MGC130008, MGC130009, SPR-1, Validated applications: ICC, IHC, Uniprot ID: Q02446, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SP4
Gene Description Sp4 transcription factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence NQATGQQQIIIDPSQGLVQLQNQPQQLELVTTQLAGNAWQLVASTPPASKENNVSQP
Immunogen NQATGQQQIIIDPSQGLVQLQNQPQQLELVTTQLAGNAWQLVASTPPASKENNVSQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HF1B, MGC130008, MGC130009, SPR-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q02446
HTS Code 3002150000
Gene ID 6671
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SP4 Antibody 100ul

Anti-SP4 Antibody 100ul