MMP15,MT2-MMP
  • MMP15,MT2-MMP

Anti-MMP15 Antibody 100ul

Ref: AN-HPA040390-100ul
Anti-MMP15

Información del producto

Polyclonal Antibody against Human MMP15, Gene description: matrix metallopeptidase 15 (membrane-inserted), Alternative Gene Names: MT2-MMP, MTMMP2, SMCP-2, Validated applications: IHC, Uniprot ID: P51511, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MMP15
Gene Description matrix metallopeptidase 15 (membrane-inserted)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMV
Immunogen RDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MT2-MMP, MTMMP2, SMCP-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51511
HTS Code 3002150000
Gene ID 4324
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MMP15 Antibody 100ul

Anti-MMP15 Antibody 100ul