CKAP5,ch-TOG
  • CKAP5,ch-TOG

Anti-CKAP5 Antibody 25ul

Ref: AN-HPA040375-25ul
Anti-CKAP5

Información del producto

Polyclonal Antibody against Human CKAP5, Gene description: cytoskeleton associated protein 5, Alternative Gene Names: ch-TOG, KIAA0097, TOG, TOGp, Validated applications: ICC, IHC, Uniprot ID: Q14008, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CKAP5
Gene Description cytoskeleton associated protein 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence MSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTASTINFI
Immunogen MSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTASTINFI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ch-TOG, KIAA0097, TOG, TOGp
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14008
HTS Code 3002150000
Gene ID 9793
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CKAP5 Antibody 25ul

Anti-CKAP5 Antibody 25ul