PIGN,MDC4,PIG-N
  • PIGN,MDC4,PIG-N

Anti-PIGN Antibody 25ul

Ref: AN-HPA040374-25ul
Anti-PIGN

Información del producto

Polyclonal Antibody against Human PIGN, Gene description: phosphatidylinositol glycan anchor biosynthesis, class N, Alternative Gene Names: MDC4, PIG-N, Validated applications: ICC, IHC, Uniprot ID: O95427, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PIGN
Gene Description phosphatidylinositol glycan anchor biosynthesis, class N
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence KVDDGVKEIVSMFNHFYGNDGKTTFIFTSDHGMTDWGSHGAGHPSETLTPLVTWGAGIKYPQRVSAQQFDDAFLKEWRLENWK
Immunogen KVDDGVKEIVSMFNHFYGNDGKTTFIFTSDHGMTDWGSHGAGHPSETLTPLVTWGAGIKYPQRVSAQQFDDAFLKEWRLENWK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MDC4, PIG-N
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95427
HTS Code 3002150000
Gene ID 23556
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PIGN Antibody 25ul

Anti-PIGN Antibody 25ul