RAPGEF3,bcm910
  • RAPGEF3,bcm910

Anti-RAPGEF3 Antibody 25ul

Ref: AN-HPA040365-25ul
Anti-RAPGEF3

Información del producto

Polyclonal Antibody against Human RAPGEF3, Gene description: Rap guanine nucleotide exchange factor (GEF) 3, Alternative Gene Names: bcm910, cAMP-GEFI, EPAC, Validated applications: IHC, Uniprot ID: O95398, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RAPGEF3
Gene Description Rap guanine nucleotide exchange factor (GEF) 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LAVEDSPALGAPRVGALPDVVPEGTLLNMVLRRMHRPRSCSYQLLLEHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNL
Immunogen LAVEDSPALGAPRVGALPDVVPEGTLLNMVLRRMHRPRSCSYQLLLEHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bcm910, cAMP-GEFI, EPAC
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95398
HTS Code 3002150000
Gene ID 10411
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RAPGEF3 Antibody 25ul

Anti-RAPGEF3 Antibody 25ul