CX3CL1,ABCD-3
  • CX3CL1,ABCD-3

Anti-CX3CL1 Antibody 25ul

Ref: AN-HPA040361-25ul
Anti-CX3CL1

Información del producto

Polyclonal Antibody against Human CX3CL1, Gene description: chemokine (C-X3-C motif) ligand 1, Alternative Gene Names: ABCD-3, C3Xkine, CXC3, CXC3C, fractalkine, neurotactin, NTN, SCYD1, Validated applications: IHC, Uniprot ID: P78423, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CX3CL1
Gene Description chemokine (C-X3-C motif) ligand 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE
Immunogen GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ABCD-3, C3Xkine, CXC3, CXC3C, fractalkine, neurotactin, NTN, SCYD1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P78423
HTS Code 3002150000
Gene ID 6376
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CX3CL1 Antibody 25ul

Anti-CX3CL1 Antibody 25ul