RBM26,ARRS2
  • RBM26,ARRS2

Anti-RBM26 Antibody 100ul

Ref: AN-HPA040252-100ul
Anti-RBM26

Información del producto

Polyclonal Antibody against Human RBM26, Gene description: RNA binding motif protein 26, Alternative Gene Names: ARRS2, C13orf10, FLJ20957, PPP1R132, PRO1777, SE70-2, ZC3H17, Validated applications: ICC, IHC, WB, Uniprot ID: Q5T8P6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RBM26
Gene Description RNA binding motif protein 26
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PPLTPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPPSLFTADTYDTDGY
Immunogen PPLTPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPPSLFTADTYDTDGY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARRS2, C13orf10, FLJ20957, PPP1R132, PRO1777, SE70-2, ZC3H17
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T8P6
HTS Code 3002150000
Gene ID 64062
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RBM26 Antibody 100ul

Anti-RBM26 Antibody 100ul