HOMER2,CPD,Cupidin
  • HOMER2,CPD,Cupidin

Anti-HOMER2 Antibody 25ul

Ref: AN-HPA040134-25ul
Anti-HOMER2

Información del producto

Polyclonal Antibody against Human HOMER2, Gene description: homer homolog 2 (Drosophila), Alternative Gene Names: CPD, Cupidin, HOMER-2, HOMER-2A, HOMER-2B, Vesl-2, Validated applications: IHC, WB, Uniprot ID: Q9NSB8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HOMER2
Gene Description homer homolog 2 (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence IIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKLGTDN
Immunogen IIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKLGTDN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CPD, Cupidin, HOMER-2, HOMER-2A, HOMER-2B, Vesl-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NSB8
HTS Code 3002150000
Gene ID 9455
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HOMER2 Antibody 25ul

Anti-HOMER2 Antibody 25ul