FAM216B,C13orf30
  • FAM216B,C13orf30

Anti-FAM216B Antibody 25ul

Ref: AN-HPA040118-25ul
Anti-FAM216B

Información del producto

Polyclonal Antibody against Human FAM216B, Gene description: family with sequence similarity 216, member B, Alternative Gene Names: C13orf30, FLJ40919, Validated applications: IHC, Uniprot ID: Q8N7L0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAM216B
Gene Description family with sequence similarity 216, member B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIYNSRPQWEALQTRYIHSLQHQQLLGYITQREALSYALVLRDSTKRASAKVAPQRTIPRK
Immunogen NWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIYNSRPQWEALQTRYIHSLQHQQLLGYITQREALSYALVLRDSTKRASAKVAPQRTIPRK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C13orf30, FLJ40919
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N7L0
HTS Code 3002150000
Gene ID 144809
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FAM216B Antibody 25ul

Anti-FAM216B Antibody 25ul