WDR66,CaM-IP4
  • WDR66,CaM-IP4

Anti-WDR66 Antibody 100ul

Ref: AN-HPA040005-100ul
Anti-WDR66

Información del producto

Polyclonal Antibody against Human WDR66, Gene description: WD repeat domain 66, Alternative Gene Names: CaM-IP4, MGC33630, Validated applications: IHC, WB, Uniprot ID: Q8TBY9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name WDR66
Gene Description WD repeat domain 66
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence REGKFYRELEDYFYYSQLRSQGIDTMETRKVSEHICLSELPFVMRAIGFYPSEEKIDDIFNEIKFGEYVDTGKLIDKINLPDFLKVYLNHKPPFGNTMSGI
Immunogen REGKFYRELEDYFYYSQLRSQGIDTMETRKVSEHICLSELPFVMRAIGFYPSEEKIDDIFNEIKFGEYVDTGKLIDKINLPDFLKVYLNHKPPFGNTMSGI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CaM-IP4, MGC33630
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TBY9
HTS Code 3002150000
Gene ID 144406
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-WDR66 Antibody 100ul

Anti-WDR66 Antibody 100ul