NME9,NM23-H9,TXL-2
  • NME9,NM23-H9,TXL-2

Anti-NME9 Antibody 100ul

Ref: AN-HPA040000-100ul
Anti-NME9

Información del producto

Polyclonal Antibody against Human NME9, Gene description: NME/NM23 family member 9, Alternative Gene Names: NM23-H9, TXL-2, TXNDC6, Validated applications: IHC, Uniprot ID: Q86XW9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NME9
Gene Description NME/NM23 family member 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTV
Immunogen AVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NM23-H9, TXL-2, TXNDC6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86XW9
HTS Code 3002150000
Gene ID 347736
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NME9 Antibody 100ul

Anti-NME9 Antibody 100ul