EIF2B4
  • EIF2B4

Anti-EIF2B4 Antibody 25ul

Ref: AN-HPA039993-25ul
Anti-EIF2B4

Información del producto

Polyclonal Antibody against Human EIF2B4, Gene description: eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa, Alternative Gene Names: DKFZP586J0119, EIF-2B, EIF2B, EIF2Bdelta, Validated applications: ICC, Uniprot ID: Q9UI10, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EIF2B4
Gene Description eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAER
Immunogen VGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAER
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP586J0119, EIF-2B, EIF2B, EIF2Bdelta
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UI10
HTS Code 3002150000
Gene ID 8890
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EIF2B4 Antibody 25ul

Anti-EIF2B4 Antibody 25ul