CPSF6,CFIM,CFIM68
  • CPSF6,CFIM,CFIM68

Anti-CPSF6 Antibody 100ul

Ref: AN-HPA039973-100ul
Anti-CPSF6

Información del producto

Polyclonal Antibody against Human CPSF6, Gene description: cleavage and polyadenylation specific factor 6, 68kDa, Alternative Gene Names: CFIM, CFIM68, HPBRII-4, HPBRII-7, Validated applications: ICC, IHC, WB, Uniprot ID: Q16630, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CPSF6
Gene Description cleavage and polyadenylation specific factor 6, 68kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, WB, IHC
Sequence ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVN
Immunogen ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CFIM, CFIM68, HPBRII-4, HPBRII-7
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16630
HTS Code 3002150000
Gene ID 11052
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CPSF6 Antibody 100ul

Anti-CPSF6 Antibody 100ul