FANCI,FLJ10719
  • FANCI,FLJ10719

Anti-FANCI Antibody 25ul

Ref: AN-HPA039972-25ul
Anti-FANCI

Información del producto

Polyclonal Antibody against Human FANCI, Gene description: Fanconi anemia, complementation group I, Alternative Gene Names: FLJ10719, KIAA1794, Validated applications: IHC, Uniprot ID: Q9NVI1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FANCI
Gene Description Fanconi anemia, complementation group I
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YGKGVLSGEECKKQLINTLCSGRWDQQYVIQLTSMFKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLVYQLLVLSSKGSRKSVLEGIIAFFSALDKQHNEEQSGDELLDVVTVPSGE
Immunogen YGKGVLSGEECKKQLINTLCSGRWDQQYVIQLTSMFKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLVYQLLVLSSKGSRKSVLEGIIAFFSALDKQHNEEQSGDELLDVVTVPSGE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10719, KIAA1794
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NVI1
HTS Code 3002150000
Gene ID 55215
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FANCI Antibody 25ul

Anti-FANCI Antibody 25ul