PAAF1,FLJ11848
  • PAAF1,FLJ11848

Anti-PAAF1 Antibody 100ul

Ref: AN-HPA039952-100ul
Anti-PAAF1

Información del producto

Polyclonal Antibody against Human PAAF1, Gene description: proteasomal ATPase-associated factor 1, Alternative Gene Names: FLJ11848, Rpn14, WDR71, Validated applications: IHC, WB, Uniprot ID: Q9BRP4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PAAF1
Gene Description proteasomal ATPase-associated factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence GNIYQLDVRSPRAPVQVIHRSGAPVLSLLSVRDGFIASQGDGSCFIVQQDLDYVTELTGADCDPVYKVATWEKQIYTCCRDGLVRRYQLSDL
Immunogen GNIYQLDVRSPRAPVQVIHRSGAPVLSLLSVRDGFIASQGDGSCFIVQQDLDYVTELTGADCDPVYKVATWEKQIYTCCRDGLVRRYQLSDL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ11848, Rpn14, WDR71
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BRP4
HTS Code 3002150000
Gene ID 80227
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PAAF1 Antibody 100ul

Anti-PAAF1 Antibody 100ul