UBE3C,KIAA0010
  • UBE3C,KIAA0010

Anti-UBE3C Antibody 100ul

Ref: AN-HPA039915-100ul
Anti-UBE3C

Información del producto

Polyclonal Antibody against Human UBE3C, Gene description: ubiquitin protein ligase E3C, Alternative Gene Names: KIAA0010, KIAA10, Validated applications: ICC, IHC, Uniprot ID: Q15386, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UBE3C
Gene Description ubiquitin protein ligase E3C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VTTSSEMQQCIQMEQKRWIQLFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGRIGPLQSTLDVGLESPPLSVSE
Immunogen VTTSSEMQQCIQMEQKRWIQLFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGRIGPLQSTLDVGLESPPLSVSE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0010, KIAA10
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15386
HTS Code 3002150000
Gene ID 9690
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-UBE3C Antibody 100ul

Anti-UBE3C Antibody 100ul