TRMT112,HSPC152
  • TRMT112,HSPC152

Anti-TRMT112 Antibody 100ul

Ref: AN-HPA039901-100ul
Anti-TRMT112

Información del producto

Polyclonal Antibody against Human TRMT112, Gene description: tRNA methyltransferase 11-2 homolog (S. cerevisiae), Alternative Gene Names: HSPC152, HSPC170, TRM112, TRMT11-2, Validated applications: IHC, WB, Uniprot ID: Q9UI30, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TRMT112
Gene Description tRNA methyltransferase 11-2 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRL
Immunogen MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSPC152, HSPC170, TRM112, TRMT11-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UI30
HTS Code 3002150000
Gene ID 51504
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TRMT112 Antibody 100ul

Anti-TRMT112 Antibody 100ul