NEDD4,KIAA0093
  • NEDD4,KIAA0093

Anti-NEDD4 Antibody 25ul

Ref: AN-HPA039883-25ul
Anti-NEDD4

Información del producto

Polyclonal Antibody against Human NEDD4, Gene description: neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase, Alternative Gene Names: KIAA0093, MGC176705, NEDD4-1, RPF1, Validated applications: IHC, Uniprot ID: P46934, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NEDD4
Gene Description neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLHSDSEYIKLMHRTSACLPSSQNVDCQININGELERPHSQMNKNHGILRRSISLG
Immunogen TVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLHSDSEYIKLMHRTSACLPSSQNVDCQININGELERPHSQMNKNHGILRRSISLG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0093, MGC176705, NEDD4-1, RPF1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P46934
HTS Code 3002150000
Gene ID 4734
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NEDD4 Antibody 25ul

Anti-NEDD4 Antibody 25ul