BCO2,B-DIOX-II
  • BCO2,B-DIOX-II

Anti-BCO2 Antibody 25ul

Ref: AN-HPA039825-25ul
Anti-BCO2

Información del producto

Polyclonal Antibody against Human BCO2, Gene description: beta-carotene oxygenase 2, Alternative Gene Names: B-DIOX-II, BCDO2, FLJ34464, Validated applications: IHC, Uniprot ID: Q9BYV7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name BCO2
Gene Description beta-carotene oxygenase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VDFLPVMVHRLPVFKRYMGNTPQKKAVFGQCRGLPCVAPLLTTVEEAPRGISARVWGHFPKWLNGSLLRIGPGKFEFGKDKYNHW
Immunogen VDFLPVMVHRLPVFKRYMGNTPQKKAVFGQCRGLPCVAPLLTTVEEAPRGISARVWGHFPKWLNGSLLRIGPGKFEFGKDKYNHW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B-DIOX-II, BCDO2, FLJ34464
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BYV7
HTS Code 3002150000
Gene ID 83875
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BCO2 Antibody 25ul

Anti-BCO2 Antibody 25ul